CCBL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157482

Catalog No. NBP157482

Description

CCBL2 Polyclonal specifically detects CCBL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCBL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CCBL2
• Immunogen: Synthetic peptides corresponding to CCBL2(cysteine conjugate-beta lyase 2) The peptide sequence was selected from the C terminal of CCBL2. Peptide sequence LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Equine: 92%; Pig: 92%; Chicken: 85%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: cysteine conjugate-beta lyase 2, Cysteine-S-conjugate beta-lyase 2, DKFZp547N1117, EC 2.6.1.63, EC 2.6.1.7, EC 4.4.1.13, KAT3DKFZp667D0223, KATIII, Kynurenine aminotransferase III, Kynurenine--glyoxylate transaminase, kynurenine-oxoglutarate transaminase 3, kynurenine--oxoglutarate transaminase 3, Kynurenine--oxoglutarate transaminase III, MGC9398, RBM1, RP11-82K18.3, RP4-531M19.2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56267
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.