Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCBL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	CCBL2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP157482 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157482	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CCBL2 Polyclonal specifically detects CCBL2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CCBL2
Classification	Polyclonal
Host Species	Rabbit
Gene Alias	cysteine conjugate-beta lyase 2, Cysteine-S-conjugate beta-lyase 2, DKFZp547N1117, EC 2.6.1.63, EC 2.6.1.7, EC 4.4.1.13, KAT3DKFZp667D0223, KATIII, Kynurenine aminotransferase III, Kynurenine--glyoxylate transaminase, kynurenine-oxoglutarate transaminase 3, kynurenine--oxoglutarate transaminase 3, Kynurenine--oxoglutarate transaminase III, MGC9398, RBM1, RP11-82K18.3, RP4-531M19.2
Gene Symbols	CCBL2
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	56267
Immunogen	Synthetic peptides corresponding to CCBL2(cysteine conjugate-beta lyase 2) The peptide sequence was selected from the C terminal of CCBL2. Peptide sequence LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CCBL2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents