Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC109A Antibody (CL3576), Novus Biologicals™
SDP

Catalog No. NBP259029 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP259029 100 μL
NB403064 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP259029 Supplier Novus Biologicals Supplier No. NBP259029
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

CCDC109A Monoclonal specifically detects CCDC109A in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.

Specifications

Antigen CCDC109A
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml, Immunocytochemistry/Immunofluorescence 2-10 ug/ml, Knockdown Validated
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias C10orf42, coiled-coil domain containing 109A, coiled-coil domain-containing protein 109A, FLJ46135
Gene Symbols MCU
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGE
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 90550
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.