Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC109A Antibody (CL3576), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $646.00
Specifications
Antigen | CCDC109A |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Monoclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
CCDC109A Monoclonal specifically detects CCDC109A in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Specifications
CCDC109A | |
Monoclonal | |
Purified | |
RUO | |
C10orf42, coiled-coil domain containing 109A, coiled-coil domain-containing protein 109A, FLJ46135 | |
MCU | |
IgG1 | |
Protein A purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
Mouse | |
Human | |
90550 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title