Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCDC109A Antibody (CL3576), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $646.00

Specifications

Antigen	CCDC109A
Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Classification	Monoclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP259029 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP259029	100 μL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB403064 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25902925UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CCDC109A Monoclonal specifically detects CCDC109A in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.

Specifications

Antigen	CCDC109A
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	C10orf42, coiled-coil domain containing 109A, coiled-coil domain-containing protein 109A, FLJ46135
Gene Symbols	MCU
Isotype	IgG1
Purification Method	Protein A purified

Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Host Species	Mouse
Target Species	Human
Gene ID (Entrez)	90550
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CCDC109A Antibody (CL3576), Novus Biologicals™

Specifications

Description

Specifications

Documents