CCDC112 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159468

Catalog No. NBP159468

Description

CCDC112 Polyclonal specifically detects CCDC112 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCDC112
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: coiled-coil domain containing 112, coiled-coil domain-containing protein 112, MBC1, MGC39633, mutated in bladder cancer 1, Mutated in bladder cancer protein 1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 153733
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q6A334
• Gene Symbols: CCDC112
• Immunogen: Synthetic peptides corresponding to MGC39633 The peptide sequence was selected from the N terminal of MGC39633. Peptide sequence VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Crab-eating macaque: 100%; Mouse: 85%; Rat: 78%;.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine, Rabbit
• Form: Purified