Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC112 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CCDC112 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
CCDC112 Polyclonal specifically detects CCDC112 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CCDC112 | |
Polyclonal | |
Purified | |
RUO | |
coiled-coil domain containing 112, coiled-coil domain-containing protein 112, MBC1, MGC39633, mutated in bladder cancer 1, Mutated in bladder cancer protein 1 | |
CCDC112 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Q6A334 | |
153733 | |
Synthetic peptides corresponding to MGC39633 The peptide sequence was selected from the N terminal of MGC39633. Peptide sequence VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title