Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CCDC28A Antibody, Novus Biologicals™

CCDC28A Antibody, Novus Biologicals™
SDP

Catalog No. NBP179581 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179581 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179581 Supplier Novus Biologicals Supplier No. NBP179581
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CCDC28A Polyclonal specifically detects CCDC28A in Human samples. It is validated for Western Blot.

Specifications

Antigen CCDC28A
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_056254
Gene Alias C6orf80, CCRL1APMGC131913, chemokine C-C motif receptor-like 1 adjacent, chromosome 6 open reading frame 80, coiled-coil domain containing 28A, coiled-coil domain-containing protein 28A, DKFZp586D0623
Gene Symbols CCDC28A
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human CCDC28AThe immunogen for this antibody is CCDC28A. Peptide sequence ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE.
Molecular Weight of Antigen 39 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 25901
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.