Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15675720UL
Description
CCDC7 Polyclonal specifically detects CCDC7 in Human samples. It is validated for Western Blot.Specifications
CCDC7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96M83 | |
CCDC7 | |
Synthetic peptides corresponding to CCDC7(coiled-coil domain containing 7) The peptide sequence was selected from the N terminal of CCDC7. Peptide sequence KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
BioT2-A, BioT2-B, BioT2-C, coiled-coil domain containing 7, coiled-coil domain-containing protein 7, DKFZp686N0559, FLJ32762, RP11-479G22.1 | |
Rabbit | |
Affinity Purified | |
RUO | |
221016 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction