Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CCDC7 Antibody, Novus Biologicals™

CCDC7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15675720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15675720 20 μL
NBP156757 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15675720 Supplier Novus Biologicals Supplier No. NBP15675720UL

Description

Rabbit Polyclonal Antibody

CCDC7 Polyclonal specifically detects CCDC7 in Human samples. It is validated for Western Blot.

Specifications

Antigen CCDC7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96M83
Gene Alias BioT2-A, BioT2-B, BioT2-C, coiled-coil domain containing 7, coiled-coil domain-containing protein 7, DKFZp686N0559, FLJ32762, RP11-479G22.1
Gene Symbols CCDC7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CCDC7(coiled-coil domain containing 7) The peptide sequence was selected from the N terminal of CCDC7. Peptide sequence KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 221016
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.