Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CCDC7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15675720
|
Novus Biologicals
NBP15675720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156757
|
Novus Biologicals
NBP156757 |
100 μL |
Each for $487.50
|
|
|||||
Description
CCDC7 Polyclonal specifically detects CCDC7 in Human samples. It is validated for Western Blot.Specifications
| CCDC7 | |
| Polyclonal | |
| Rabbit | |
| Q96M83 | |
| 221016 | |
| Synthetic peptides corresponding to CCDC7(coiled-coil domain containing 7) The peptide sequence was selected from the N terminal of CCDC7. Peptide sequence KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BioT2-A, BioT2-B, BioT2-C, coiled-coil domain containing 7, coiled-coil domain-containing protein 7, DKFZp686N0559, FLJ32762, RP11-479G22.1 | |
| CCDC7 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title