Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC74A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | CCDC74A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CCDC74A Polyclonal specifically detects CCDC74A in Human samples. It is validated for Western Blot.Specifications
CCDC74A | |
Polyclonal | |
Rabbit | |
Q96AQ1 | |
90557 | |
Synthetic peptides corresponding to CCDC74A(coiled-coil domain containing 74A) The peptide sequence was selected from the middle region of CCDC74A. Peptide sequence FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
coiled-coil domain containing 74A, coiled-coil domain-containing protein 74A, FLJ40345 | |
CCDC74A | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title