Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCDC74A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$492.89
Specifications
| Antigen | CCDC74A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCDC74A Polyclonal specifically detects CCDC74A in Human samples. It is validated for Western Blot.Specifications
| CCDC74A | |
| Polyclonal | |
| Rabbit | |
| Q96AQ1 | |
| 90557 | |
| Synthetic peptides corresponding to CCDC74A(coiled-coil domain containing 74A) The peptide sequence was selected from the middle region of CCDC74A. Peptide sequence FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| coiled-coil domain containing 74A, coiled-coil domain-containing protein 74A, FLJ40345 | |
| CCDC74A | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title