CCDC76 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157022

Catalog No. NBP157022

Description

CCDC76 Polyclonal specifically detects CCDC76 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCDC76
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: coiled-coil domain containing 76, Coiled-coil domain-containing protein 76, EC 2.1.1.-, FLJ10287, FLJ11219, tRNA [Gm4] methyltransferase, tRNA guanosine-2'-O-methyltransferase TRM13 homolog
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54482
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NUP7
• Gene Symbols: TRMT13
• Immunogen: Synthetic peptides corresponding to CCDC76 (coiled-coil domain containing 76) The peptide sequence was selected from the N terminal of CCDC76. Peptide sequence QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Rat: 92%; Xenopus: 84%; Rabbit: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG