CCDC85B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21445725UL

Catalog No. NB437875

Description

CCDC85B Polyclonal specifically detects CCDC85B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCDC85B
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: coiled-coil domain containing 85B, coiled-coil domain-containing protein 85B, DIPADelta-interacting protein A, hepatitis delta antigen interacting protein A, Hepatitis delta antigen-interacting protein A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11007
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CCDC85B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRE
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only