Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCL13/MCP-4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17993620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17993620 20 μL
NBP179936 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17993620 Supplier Novus Biologicals Supplier No. NBP17993620UL

Rabbit Polyclonal Antibody

CCL13/MCP-4 Polyclonal specifically detects CCL13/MCP-4 in Human samples. It is validated for Western Blot.

Specifications

Antigen CCL13/MCP-4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_005399
Gene Alias C-C motif chemokine 13, chemokine (C-C motif) ligand 13, CKb10, MCP4, MCP-4Monocyte chemoattractant protein 4, MGC17134, NCC-1Monocyte chemotactic protein 4, NCC1Small-inducible cytokine A13, new CC chemokine 1, SCYA13CK-beta-10, SCYL1, small inducible cytokine subfamily A (Cys-Cys), member 13
Gene Symbols CCL13
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human CCL13. Peptide sequence KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.
Molecular Weight of Antigen 11 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 6357
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.