Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCL13/MCP-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17993620UL
Description
CCL13/MCP-4 Polyclonal specifically detects CCL13/MCP-4 in Human samples. It is validated for Western Blot.Specifications
CCL13/MCP-4 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_005399 | |
CCL13 | |
Synthetic peptide directed towards the middle region of human CCL13. Peptide sequence KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C-C motif chemokine 13, chemokine (C-C motif) ligand 13, CKb10, MCP4, MCP-4Monocyte chemoattractant protein 4, MGC17134, NCC-1Monocyte chemotactic protein 4, NCC1Small-inducible cytokine A13, new CC chemokine 1, SCYA13CK-beta-10, SCYL1, small inducible cytokine subfamily A (Cys-Cys), member 13 | |
Rabbit | |
11 kDa | |
20 μL | |
Cancer | |
6357 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction