Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCL13/MCP-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	CCL13/MCP-4
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17993620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17993620UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP179936 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179936	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CCL13/MCP-4 Polyclonal specifically detects CCL13/MCP-4 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CCL13/MCP-4
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cancer
Gene Accession No.	NP_005399
Gene ID (Entrez)	6357
Immunogen	Synthetic peptide directed towards the middle region of human CCL13. Peptide sequence KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	C-C motif chemokine 13, chemokine (C-C motif) ligand 13, CKb10, MCP4, MCP-4Monocyte chemoattractant protein 4, MGC17134, NCC-1Monocyte chemotactic protein 4, NCC1Small-inducible cytokine A13, new CC chemokine 1, SCYA13CK-beta-10, SCYL1, small inducible cytokine subfamily A (Cys-Cys), member 13
Gene Symbols	CCL13
Isotype	IgG
Molecular Weight of Antigen	11 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CCL13/MCP-4 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents