Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCL19/MIP-3 beta Antibody, Novus Biologicals™
SDP

Catalog No. NB403749 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403749 25 μL
NBP256275 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403749 Supplier Novus Biologicals Supplier No. NBP25627525UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CCL19/MIP-3 beta Polyclonal specifically detects CCL19/MIP-3 beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CCL19/MIP-3 beta
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias beta chemokine exodus-3, Beta-chemokine exodus-3, CC chemokine ligand 19, C-C motif chemokine 19, chemokine (C-C motif) ligand 19, CKb11, EBI1-ligand chemokine, ELCMIP-3-beta, Epstein-Barr virus-induced molecule 1 ligand chemokine, exodus-3, Macrophage inflammatory protein 3 beta, macrophage inflammatory protein 3-beta, MGC34433, MIP-3b, MIP3BCK beta-11, SCYA19EBI1 ligand chemokine, small inducible cytokine subfamily A (Cys-Cys), member 19, Small-inducible cytokine A19
Gene Symbols CCL19
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6363
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.