CCL21/6Ckine Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP237928

Catalog No. NBP237928

Description

CCL21/6Ckine Polyclonal specifically detects CCL21/6Ckine in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCL21/6Ckine
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: O00585
• Gene Symbols: CCL21
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cell Cycle and Replication
• Gene ID (Entrez): 6366
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 6CkineSmall-inducible cytokine A21, Beta-chemokine exodus-2, chemokine (C-C motif) ligand 21, CKb9, member 21, SCYA21MGC34555, secondary lymphoid tissue chemokine, SLCSecondary lymphoid-tissue chemokine
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.