Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CCL27/CTACK Antibody, Novus Biologicals™

CCL27/CTACK Antibody, Novus Biologicals™
SDP

Catalog No. NB393046 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393046 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB393046 Supplier Novus Biologicals Supplier No. NBP26268425UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CCL27/CTACK Polyclonal antibody specifically detects CCL27/CTACK in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen CCL27/CTACK
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias ALP, C-C motif chemokine 27, chemokine (C-C motif) ligand 27, CTACKSmall-inducible cytokine A27, CTAK, cutaneous T-cell attracting chemokine, Cutaneous T-cell-attracting chemokine, ESKINE, IL-11 Ralpha-locus chemokine, ILCCC chemokine ILC, PESKY, SCYA27IL-11 R-alpha-locus chemokine, skinkine, small inducible cytokine subfamily A (Cys-Cys), member 27
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Biologically Active Proteins
Primary or Secondary Primary
Gene ID (Entrez) 10850
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.