Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CCM2L Antibody, Novus Biologicals™

CCM2L Antibody, Novus Biologicals™
SDP

Catalog No. NBP1704620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1704620 20 μL
NBP170461 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1704620 Supplier Novus Biologicals Supplier No. NBP17046120UL

Description

Rabbit Polyclonal Antibody

CCM2L Polyclonal specifically detects CCM2L in Human samples. It is validated for Western Blot.

Specifications

Antigen C20orf160
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias chromosome 20 open reading frame 160, dJ310O13.5
Gene Symbols CCM2L
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C20ORF160 The peptide sequence was selected from the N terminal of C20ORF160. Peptide sequence LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL.
Molecular Weight of Antigen 47 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 140706
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.