CCNB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180127

Catalog No. NBP180127

Description

CCNB3 Polyclonal specifically detects CCNB3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCNB3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3
• Host Species: Rabbit
• Molecular Weight of Antigen: 291 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 85417
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_391990
• Gene Symbols: CCNB3
• Immunogen: Synthetic peptide directed towards the N terminal of human CCNB3. Peptide sequence: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Dog: 82%.
• Target Species: Human, Canine
• Form: Purified