Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CCNB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18012720UL
Description
CCNB3 Polyclonal specifically detects CCNB3 in Human samples. It is validated for Western Blot.Specifications
CCNB3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_391990 | |
CCNB3 | |
Synthetic peptide directed towards the N terminal of human CCNB3. Peptide sequence: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3 | |
Rabbit | |
291 kDa | |
20 μL | |
Cell Cycle and Replication | |
85417 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction