Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CCNB3 Antibody, Novus Biologicals™

CCNB3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1802720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1802720 20 μL
NBP180127 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1802720 Supplier Novus Biologicals Supplier No. NBP18012720UL

Description

Rabbit Polyclonal Antibody

CCNB3 Polyclonal specifically detects CCNB3 in Human samples. It is validated for Western Blot.

Specifications

Antigen CCNB3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_391990
Gene Alias CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3
Gene Symbols CCNB3
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human CCNB3. Peptide sequence: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
Molecular Weight of Antigen 291 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 85417
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.