Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CCNB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	CCNB3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP1802720 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18012720UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP180127 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP180127	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CCNB3 Polyclonal specifically detects CCNB3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CCNB3
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	NP_391990
Gene ID (Entrez)	85417
Immunogen	Synthetic peptide directed towards the N terminal of human CCNB3. Peptide sequence: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
Primary or Secondary	Primary
Molecular Weight of Antigen	291 kDa

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	CYCB3, cyclin B3, G2/mitotic-specific cyclin-B3
Gene Symbols	CCNB3
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CCNB3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents