CCRL2/CRAM-A/B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP185588

Catalog No. NBP185588

Description

CCRL2/CRAM-A/B Polyclonal specifically detects CCRL2/CRAM-A/B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CCRL2/CRAM-A/B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: C-C chemokine receptor-like 2, CCR11, CCR6, chemokine (C-C motif) receptor-like 2, Chemokine receptor CCR11, Chemokine receptor X, CKRXMGC116710, CRAM, CRAM-A, CRAM-B, FLJ55815, HCRMGC34104, Putative MCP-1 chemokine receptor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CCRL2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
• Quantity: 0.1 mL
• Research Discipline: GPCR, Immunology, Innate Immunity
• Gene ID (Entrez): 9034
• Target Species: Human
• Isotype: IgG

For Research Use Only