CCT8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156608

Catalog No. NBP156608

Description

CCT8 Polyclonal specifically detects CCT8 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: CCT8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CCT8
• Immunogen: Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: theta.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C21orf112, CCTQ, CCT-theta, chaperonin containing TCP1, subunit 8 (theta), chromosome 21 open reading frame 112, D21S246, KIAA0002, PRED71, T-complex protein 1 subunit theta, T-complex protein 1, theta subunit, 10Renal carcinoma antigen NY-REN-15, TCP-1-theta
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10694
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.