CCT8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15660820UL

Catalog No. NBP15660820

Description

CCT8 Polyclonal specifically detects CCT8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CCT8
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Alias: C21orf112, CCTQ, CCT-theta, chaperonin containing TCP1, subunit 8 (theta), chromosome 21 open reading frame 112, D21S246, KIAA0002, PRED71, T-complex protein 1 subunit theta, T-complex protein 1, theta subunit, 10Renal carcinoma antigen NY-REN-15, TCP-1-theta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10694
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CCT8
• Immunogen: Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: theta.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.