CD1d Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257561

Catalog No. NBP257561

Description

CD1d Polyclonal specifically detects CD1d in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CD1d
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: antigen-presenting glycoprotein CD1d, CD1A, CD1d antigen, CD1D antigen, d polypeptide, CD1d molecule, differentiation antigen CD1-alpha-3, HMC class I antigen-like glycoprotein CD1D, MGC34622, R3, R3G1, T-cell surface glycoprotein CD1d, thymocyte antigen CD1D
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CD1D
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW
• Quantity: 100 μL
• Research Discipline: B Cell Development and Differentiation Markers, Myeloid derived Suppressor Cell
• Gene ID (Entrez): 912
• Target Species: Human
• Isotype: IgG

For Research Use Only