Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD1d Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | CD1d |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CD1d Polyclonal specifically detects CD1d in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CD1d | |
Polyclonal | |
Rabbit | |
B Cell Development and Differentiation Markers, Myeloid derived Suppressor Cell | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
912 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
antigen-presenting glycoprotein CD1d, CD1A, CD1d antigen, CD1D antigen, d polypeptide, CD1d molecule, differentiation antigen CD1-alpha-3, HMC class I antigen-like glycoprotein CD1D, MGC34622, R3, R3G1, T-cell surface glycoprotein CD1d, thymocyte antigen CD1D | |
CD1D | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title