Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD3 epsilon Antibody, Novus Biologicals™

CD3 epsilon Antibody, Novus Biologicals™
SDP

Catalog No. NB436197 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436197 25 μL
NBP238479 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436197 Supplier Novus Biologicals Supplier No. NBP23847925UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CD3 epsilon Polyclonal specifically detects CD3 epsilon in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CD3 epsilon
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P07766
Gene Alias CD3e antigen, CD3e antigen, epsilon polypeptide (TiT3 complex), CD3e molecule, epsilon (CD3-TCR complex), CD3-epsilon, FLJ18683, T3E, T-cell antigen receptor complex, epsilon subunit of T3, T-cell surface antigen T3/Leu-4 epsilon chain, T-cell surface glycoprotein CD3 epsilon chain, TCRE
Gene Symbols CD3E
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Apoptosis, Cytokine Research, Diabetes Research, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Signal Transduction, Stem Cell Lines, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 916
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.