Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD300b/LMIR5/CD300LB Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309599100UL

 View more versions of this product

Catalog No. NB124099


Only null left
Add to Cart

Description

Description

CD300b/LMIR5/CD300LB Polyclonal specifically detects CD300b/LMIR5/CD300LB in Human samples. It is validated for Western Blot.
Specifications

Specifications

CD300b/LMIR5/CD300LB
Polyclonal
Western Blot 1.0 ug/ml
CD300 antigen like family member B, CD300 antigen-like family member B, CD300 molecule-like family member b, CD300B, CD300b antigen, CLM-7, CLM7IREM3CD300 molecule like family member b, CMRF35A2, CMRF35-A2, CMRF35-like molecule 7, EC 1.13.11.6, EC 6.3.4.3, Immune receptor expressed on myeloid cells 3, IREM-3, Leukocyte mono-Ig-like receptor 5, LMIR5, TREM-5, TREM5CD300b, Triggering receptor expressed on myeloid cells 5
The immunogen is a synthetic peptide directed towards the middle region of Human CD300b/LMIR5/CD300LB (NP_777552). Peptide sequence CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA
100 μg
Primary
Human
Purified
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
124599
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.