Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD300b/LMIR5/CD300LB Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | CD300b/LMIR5/CD300LB |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
CD300b/LMIR5/CD300LB Polyclonal specifically detects CD300b/LMIR5/CD300LB in Human samples. It is validated for Western Blot.Specifications
| CD300b/LMIR5/CD300LB | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CD300 antigen like family member B, CD300 antigen-like family member B, CD300 molecule-like family member b, CD300B, CD300b antigen, CLM-7, CLM7IREM3CD300 molecule like family member b, CMRF35A2, CMRF35-A2, CMRF35-like molecule 7, EC 1.13.11.6, EC 6.3.4.3, Immune receptor expressed on myeloid cells 3, IREM-3, Leukocyte mono-Ig-like receptor 5, LMIR5, TREM-5, TREM5CD300b, Triggering receptor expressed on myeloid cells 5 | |
| The immunogen is a synthetic peptide directed towards the middle region of Human CD300b/LMIR5/CD300LB (NP_777552). Peptide sequence CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 124599 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title