CD300c Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP184432

Catalog No. NBP184432

Description

CD300c Polyclonal specifically detects CD300c in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD300c/LMIR2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CD300c antigenCMRF35 antigen, CD300c molecule, CLM-6, CMRF-35, CMRF35 leukocyte immunoglobulin-like receptor, CMRF-35A, CMRF35A leukocyte immunoglobulin-like receptor, CMRF35ACMRF35A1, CMRF35CMRF35-A1, CMRF35-like molecule 6, IgSF16, IGSF16CD300 antigen-like family member C, Immunoglobulin superfamily member 16, LIR
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CD300C
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
• Quantity: 0.1 mL
• Research Discipline: Immunology
• Gene ID (Entrez): 10871
• Target Species: Human
• Isotype: IgG

For Research Use Only