Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD300c Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $646.00
Specifications
Antigen | CD300c/LMIR2 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CD300c Polyclonal specifically detects CD300c in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CD300c/LMIR2 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
CD300c antigenCMRF35 antigen, CD300c molecule, CLM-6, CMRF-35, CMRF35 leukocyte immunoglobulin-like receptor, CMRF-35A, CMRF35A leukocyte immunoglobulin-like receptor, CMRF35ACMRF35A1, CMRF35CMRF35-A1, CMRF35-like molecule 6, IgSF16, IGSF16CD300 antigen-like family member C, Immunoglobulin superfamily member 16, LIR | |
CD300C | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Immunology | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
10871 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title