CD39L2/ENTPD6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257315

Catalog No. NBP257315

Description

CD39L2/ENTPD6 Polyclonal specifically detects CD39L2/ENTPD6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD39L2/ENTPD6
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: CD39 antigen-like 2, CD39L2NTPDase-6, CD39-like 2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, EC 3.6.1.6, ectonucleoside triphosphate diphosphohydrolase 6, ectonucleoside triphosphate diphosphohydrolase 6 (putative function), ectonucleoside triphosphate diphosphohydrolase 6 (putative), FLJ36711, IL-6SAG, IL6ST2, interleukin 6 signal transducer-2, NTPDase 6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ENTPD6
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 955
• Target Species: Human
• Isotype: IgG

For Research Use Only