Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD39L2/ENTPD6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CD39L2/ENTPD6 |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CD39L2/ENTPD6 Polyclonal specifically detects CD39L2/ENTPD6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CD39L2/ENTPD6 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
955 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVD | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Unconjugated | |
RUO | |
Human | |
CD39 antigen-like 2, CD39L2NTPDase-6, CD39-like 2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, EC 3.6.1.6, ectonucleoside triphosphate diphosphohydrolase 6, ectonucleoside triphosphate diphosphohydrolase 6 (putative function), ectonucleoside triphosphate diphosphohydrolase 6 (putative), FLJ36711, IL-6SAG, IL6ST2, interleukin 6 signal transducer-2, NTPDase 6 | |
ENTPD6 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title