Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP185751

CD39L4/ENTPD5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP185751 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP185751 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP185751 Supplier Novus Biologicals Supplier No. NBP185751
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CD39L4/ENTPD5 Polyclonal specifically detects CD39L4/ENTPD5 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CD39L4/ENTPD5
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.05mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 μg/mL, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CD39 antigen-like 4, CD39L4NTPDase 5, CD39-like 4, EC 3.6.1, EC 3.6.1.42, EC 3.6.1.6, ectonucleoside triphosphate diphosphohydrolase 5, ER-UDPase, GDPase ENTPD5, Guanosine-diphosphatase ENTPD5, MGC163357, MGC163359, NTPDase-5, Nucleoside diphosphatase, PCPH, Pcph proto-oncogene protein, proto-oncogene CPH, UDPase ENTPD5, Uridine-diphosphatase ENTPD5
Gene Symbols ENTPD5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 957
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.