Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD40 Ligand/TNFSF5 Antibody, Novus Biologicals™

CD40 Ligand/TNFSF5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159186 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159186 100 μL
NBP15918620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159186 Supplier Novus Biologicals Supplier No. NBP159186
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CD40 Ligand/TNFSF5 Polyclonal specifically detects CD40 Ligand/TNFSF5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CD40 Ligand/TNFSF5
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P29965
Gene Alias CD154, CD154 antigen, CD40 antigen ligand, CD40 ligand, CD40-L, CD40LIGM, gp39, hCD40L, HIGM1, T-B cell-activating molecule, T-BAM, T-cell antigen Gp39, TNF-related activation protein, TNFSF5IMD3, TRAPtumor necrosis factor (ligand) superfamily, member 5 (hyper-IgM syndrome), tumor necrosis factor (ligand) superfamily member 5, Tumor necrosis factor ligand superfamily member 5
Gene Symbols CD40LG
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CD40LG(CD40 ligand (TNF superfamily, member 5, hyper-IgM syndrome)) The peptide sequence was selected from the middle region of CD40LG. Peptide sequence ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Apoptosis, Asthma, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Hypoxia, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 959
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Pig: 100%; Mouse: 83%; Rat: 83%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.