Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CD40/TNFRSF5 Antibody (CL1673), Novus Biologicals™

CD40/TNFRSF5 Antibody (CL1673), Novus Biologicals™
SDP

Catalog No. NBP234488 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP234488 0.1 mL
NB397205 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP234488 Supplier Novus Biologicals Supplier No. NBP234488
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

CD40/TNFRSF5 Monoclonal specifically detects CD40/TNFRSF5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CD40/TNFRSF5
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL1673
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Gene Accession No. P25942
Gene Alias B cell surface antigen CD40, B-cell surface antigen CD40, Bp50B cell-associated molecule, CD40 antigen, CD40 molecule, TNF receptor superfamily member 5, CD40 type II isoform, CD40L receptor, CDw40, MGC9013, nerve growth factor receptor-related B-lymphocyte activation molecule, p50, TNFRSF5CD40 antigen (TNF receptor superfamily member 5), tumor necrosis factor receptor superfamily member 5, tumor necrosis factor receptor superfamily, member 5
Gene Symbols CD40
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Apoptosis, Asthma, Cancer, Hematopoietic Stem Cell Markers, Immunology, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 958
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.