CD48/SLAMF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255445

Catalog No. NBP255445

Description

CD48/SLAMF2 Polyclonal specifically detects CD48/SLAMF2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CD48/SLAMF2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: BCM1 surface antigen, BCM1Leukocyte antigen MEM-102, BLAST, BLAST1TCT.1, B-lymphocyte activation marker BLAST-1, CD48 antigen, CD48 antigen (B-cell membrane protein), CD48 molecule, hCD48, mCD48, MEM-102, SLAMF2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CD48
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV
• Quantity: 100 μL
• Research Discipline: Cell Biology, Cellular Markers, Immunology, Stem Cell Markers
• Gene ID (Entrez): 962
• Target Species: Human
• Isotype: IgG

For Research Use Only