CD63 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP182784	0.1 mL

Catalog No. NBP182784 Supplier Novus Biologicals Supplier No. NBP182784

Description

Rabbit Polyclonal Antibody

CD63 Polyclonal specifically detects CD63 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD63
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD63 antigen, CD63 antigen (melanoma 1 antigen), CD63 molecule, Granulophysin, LAMP-3, Lysosomal-associated membrane protein 3, ME491, melanoma 1 antigen, Melanoma-associated antigen ME491, melanoma-associated antigen MLA1, MLA1lysosome-associated membrane glycoprotein 3, Ocular melanoma-associated antigen, OMA81H, Tetraspanin-30, tspan-30, TSPAN30granulophysin
• Gene Symbols: CD63
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Discipline: Autophagy, Cancer, Cardiovascular Biology, Cytokine Research, Immunology, Innate Immunity, Lysosome Markers, Metastasis
• Primary or Secondary: Primary
• Gene ID (Entrez): 967
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only