CD68/SR-D1 Antibody (CL1346), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP23448225UL

Catalog No. NB397207

Description

CD68/SR-D1 Monoclonal specifically detects CD68/SR-D1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: CD68/SR-D1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene Accession No.: P34810
• Gene Symbols: CD68
• Immunogen: This CD68/SR-D1 Antibody (CL1346) was developed against a recombinant protein corresponding to amino acids: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG
• Quantity: 25 μL
• Research Discipline: Cell Biology, Cytokine Research, Immunology, Microglia Markers
• Gene ID (Entrez): 968
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
• Clone: CL1346
• Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
• Gene Alias: CD68 antigenmacrophage antigen CD68, CD68 molecule, DKFZp686M18236, GP110, macrosialin, SCARD1, scavenger receptor class D, member 1
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human CD68/SR-D1 Antibody (CL1346) verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

For Research Use Only