Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD68/SR-D1 Antibody (CL1346), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CD68/SR-D1 |
---|---|
Clone | CL1346 |
Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
Classification | Monoclonal |
Description
CD68/SR-D1 Monoclonal specifically detects CD68/SR-D1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
CD68/SR-D1 | |
Western Blot 1:500 - 1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated | |
Monoclonal | |
Purified | |
RUO | |
Human | |
CD68 antigenmacrophage antigen CD68, CD68 molecule, DKFZp686M18236, GP110, macrosialin, SCARD1, scavenger receptor class D, member 1 | |
CD68 | |
IgG1 | |
Protein A purified | |
Specificity of human CD68/SR-D1 Antibody (CL1346) verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
CL1346 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
Mouse | |
Cell Biology, Cytokine Research, Immunology, Microglia Markers | |
P34810 | |
968 | |
This CD68/SR-D1 Antibody (CL1346) was developed against a recombinant protein corresponding to amino acids: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title