CD79B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188945

Catalog No. NBP188945

Description

CD79B Polyclonal specifically detects CD79B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CD79B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: B29B-cell-specific glycoprotein B29, B-cell antigen receptor complex-associated protein beta chain, CD79b antigen, CD79B antigen (immunoglobulin-associated beta), CD79b molecule, immunoglobulin-associated beta, IGBAGM6, Ig-beta, Immunoglobulin-associated B29 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CD79B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
• Quantity: 0.1 mL
• Research Discipline: Immunology
• Gene ID (Entrez): 974
• Target Species: Human
• Isotype: IgG

For Research Use Only