Learn More
Description
Specifications
Specifications
| Antigen | CD82/Kai-1 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 0T3L6 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | CD82 antigenC33, CD82 molecule, IA4C33 antigen, Inducible membrane protein R2, KAI1GR15, kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyteantigen, antigen detected by monoclonal and IA4)), Metastasis suppressor Kangai-1, R2, SAR2tetraspanin-27, ST6tspan-27, Suppressor of tumorigenicity 6 protein, Tetraspanin-27, Tspan-27, TSPAN274F9 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82/Kai-1 (P27701). PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
