Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD82/Kai-1 Rabbit anti-Human, Mouse, Clone: 0T3L6, Novus Biologicals™
SDP

Catalog No. NB168686 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168686 20 μg
NB168685 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB168686 Supplier Novus Biologicals Supplier No. NBP31679720UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Monoclonal Antibody

CD82/Kai-1 Monoclonal antibody specifically detects CD82/Kai-1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen CD82/Kai-1
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 0T3L6
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias CD82 antigenC33, CD82 molecule, IA4C33 antigen, Inducible membrane protein R2, KAI1GR15, kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyteantigen, antigen detected by monoclonal and IA4)), Metastasis suppressor Kangai-1, R2, SAR2tetraspanin-27, ST6tspan-27, Suppressor of tumorigenicity 6 protein, Tetraspanin-27, Tspan-27, TSPAN274F9
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82/Kai-1 (P27701). PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 3732
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.