Learn More
Description
Specifications
Specifications
| Antigen | CD9 |
| Applications | Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 10N2L6 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | BA2, BA-2/p24 antigen, BTCC-1, CD9 antigen, CD9 molecule, Cell growth-inhibiting gene 2 protein, DRAP-27, Leukocyte antigen MIC3, motility related protein-1,5H9 antigen, Motility-related protein, MRP-1FLJ99568, P24, Tetraspanin-29, TSPAN-29, TSPAN29MIC3CD9 antigen (p24) |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 129-228 of human CD9 (P21926). YNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
