Cdc23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155022

Catalog No. NBP155022

Description

Cdc23 Polyclonal specifically detects Cdc23 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cdc23
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ANAPC8anaphase promoting complex subunit 8, Anaphase-promoting complex subunit 8, APC8CDC23 (cell division cycle 23, yeast, homolog), cell division cycle 23 homolog (S. cerevisiae), cell division cycle protein 23 homolog, CUT23, Cyclosome subunit 8
• Host Species: Rabbit
• Molecular Weight of Antigen: 66 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 8697
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UJX2
• Gene Symbols: CDC23
• Immunogen: Synthetic peptides corresponding to CDC23(cell division cycle 23 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of CDC23. Peptide sequence RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG