Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cdc23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	Cdc23
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155022 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155022	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

Cdc23 Polyclonal specifically detects Cdc23 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Cdc23
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	Q9UJX2
Gene ID (Entrez)	8697
Immunogen	Synthetic peptides corresponding to CDC23(cell division cycle 23 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of CDC23. Peptide sequence RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA.
Primary or Secondary	Primary
Molecular Weight of Antigen	66 kDa

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	ANAPC8anaphase promoting complex subunit 8, Anaphase-promoting complex subunit 8, APC8CDC23 (cell division cycle 23, yeast, homolog), cell division cycle 23 homolog (S. cerevisiae), cell division cycle protein 23 homolog, CUT23, Cyclosome subunit 8
Gene Symbols	CDC23
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Cdc23 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents