Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDC42BPB Antibody, Novus Biologicals™
SDP

Catalog No. NB433881 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB433881 25ul
NBP181440 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB433881 Supplier Novus Biologicals Supplier No. NBP18144025UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CDC42BPB Polyclonal specifically detects CDC42BPB in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CDC42BPB
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:20
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CDC42 binding protein kinase beta (DMPK-like), CDC42-binding protein kinase beta, CDC42-binding protein kinase beta (DMPK-like), DMPK-like beta, EC 2.7.11, EC 2.7.11.1, FLJ37601, FLJ44730, KIAA1124DKFZp686H1431, MRCK beta, MRCKB, Myotonic dystrophy kinase-related CDC42-binding kinase beta, Myotonic dystrophy protein kinase-like beta, serine/threonine-protein kinase MRCK beta
Gene Symbols CDC42BPB
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 9578
Test Specificity Specificity of human CDC42BPB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Rat, Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.