Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDC42BPG Antibody, Novus Biologicals™
SDP

Catalog No. NB432865 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB432865 25 μL
NBP184072 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB432865 Supplier Novus Biologicals Supplier No. NBP18407225UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CDC42BPG Polyclonal specifically detects CDC42BPG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CDC42BPG
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CDC42 binding protein kinase gamma (DMPK-like), CDC42-binding protein kinase gamma, DMPK2MRCK gamma, DMPK-like gamma, EC 2.7.11, EC 2.7.11.1, HSMDPKIN, kappa-200, MRCKgamma, Myotonic dystrophy kinase-related CDC42-binding kinase gamma, myotonic dystrophy protein kinase like protein, Myotonic dystrophy protein kinase-like alpha, Myotonic dystrophy protein kinase-like gamma, serine/threonine-protein kinase MRCK gamma
Gene Symbols CDC42BPG
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSH
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 55561
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.