Learn More
Description
Specifications
Specifications
| Antigen | CDC42BPG |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | CDC42 binding protein kinase gamma (DMPK-like), CDC42-binding protein kinase gamma, DMPK2MRCK gamma, DMPK-like gamma, EC 2.7.11, EC 2.7.11.1, HSMDPKIN, kappa-200, MRCKgamma, Myotonic dystrophy kinase-related CDC42-binding kinase gamma, myotonic dystrophy protein kinase like protein, Myotonic dystrophy protein kinase-like alpha, Myotonic dystrophy protein kinase-like gamma, serine/threonine-protein kinase MRCK gamma |
| Gene Symbols | CDC42BPG |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PSNSLIPFLSFRSSEKDSAKDPGISGEATRHGGEPDLRPEGRRSLRMGAVFPRAPTANTASTEGLPAKPGSH |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
