Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDC42BPG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238938
Description
CDC42BPG Polyclonal specifically detects CDC42BPG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CDC42BPG | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q6DT37 | |
CDC42BPG | |
This antibody was developed against a recombinant protein corresponding to amino acids: SNDIFQVGECRRVQQLTLSPSAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQVLAAGSILQARTPVLCV | |
0.1 mL | |
Protein Kinase | |
55561 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CDC42 binding protein kinase gamma (DMPK-like), CDC42-binding protein kinase gamma, DMPK2MRCK gamma, DMPK-like gamma, EC 2.7.11, EC 2.7.11.1, HSMDPKIN, kappa-200, MRCKgamma, Myotonic dystrophy kinase-related CDC42-binding kinase gamma, myotonic dystrophy protein kinase like protein, Myotonic dystrophy protein kinase-like alpha, Myotonic dystrophy protein kinase-like gamma, serine/threonine-protein kinase MRCK gamma | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction