Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDC42BPG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | CDC42BPG |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
CDC42BPG Polyclonal specifically detects CDC42BPG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CDC42BPG | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q6DT37 | |
| 55561 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SNDIFQVGECRRVQQLTLSPSAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQVLAAGSILQARTPVLCV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CDC42 binding protein kinase gamma (DMPK-like), CDC42-binding protein kinase gamma, DMPK2MRCK gamma, DMPK-like gamma, EC 2.7.11, EC 2.7.11.1, HSMDPKIN, kappa-200, MRCKgamma, Myotonic dystrophy kinase-related CDC42-binding kinase gamma, myotonic dystrophy protein kinase like protein, Myotonic dystrophy protein kinase-like alpha, Myotonic dystrophy protein kinase-like gamma, serine/threonine-protein kinase MRCK gamma | |
| CDC42BPG | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title